General Information

  • ID:  hor003511
  • Uniprot ID:  P85832
  • Protein name:  Orcokinin-like peptide-2
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IDEIDRTAFDNFF
  • Length:  13
  • Propeptide:  MPRHSVFALSILALSITATVWIPTVQAETNLLRREFYGPVNPELFAAFLDDHDARGRENQRDFSSGSGTNELVDELSPVSERETLERFGKRNIDEIDRTAFDNFFKRNLDEIDRVGWSGFVKRLTNYLATTGHGTNTGGPVLTRRFG
  • Signal peptide:  MPRHSVFALSILALSITATVWIPTVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85832-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003511_AF2.pdbhor003511_ESM.pdb

Physical Information

Mass: 181695 Formula: C73H103N17O24
Absent amino acids: CGHKLMPQSVWY Common amino acids: DF
pI: 3.7 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 6
Hydrophobicity: -26.92 Boman Index: -3651
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 67.69
Instability Index: 1617.69 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain